General Information

  • ID:  hor006598
  • Uniprot ID:  Q9IA09
  • Protein name:  Progonadoliberin-3
  • Gene name:  gnrh3
  • Organism:  Dicentrarchus labrax (European seabass) (Morone labrax)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGWLPGGKRSVGELEATIRMMGTGEVVSLPEEASAQTQERLRPYNVINDDSSHFDRKKRSPNK
  • Length:  67
  • Propeptide:  MEANSRVMVRVLLLALVVQVTLSQHWSYGWLPGGKRSVGELEATIRMMGTGEVVSLPEEASAQTQERLRPYNVINDDSSHFDRKKRSPNK
  • Signal peptide:  MEANSRVMVRVLLLALVVQVTLS
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9IA09-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006598_AF2.pdbhor006598_ESM.pdb

Physical Information

Mass: 880686 Formula: C330H519N101O104S2
Absent amino acids: C Common amino acids: SEGR
pI: 9.08 Basic residues: 12
Polar residues: 21 Hydrophobic residues: 16
Hydrophobicity: -103.58 Boman Index: -18730
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 56.72
Instability Index: 6449.55 Extinction Coefficient cystines: 13980
Absorbance 280nm: 211.82

Literature

  • PubMed ID:  11086295
  • Title:  Differential expression of three different prepro-GnRH (gonadotrophin-releasing hormone) messengers in the brain of the european sea bass (Dicentrarchus labrax).